Scaffold Ga0181515_1145906

Overview

Basic Information

• Taxon OID: 3300016730
• Scaffold ID: Ga0181515_1145906
• Source Dataset Name: Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_30_metaT (Metagenome Metatranscriptome)
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 3491
• Total Scaffold Genes: 5
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 3 (60.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland → Peatland Microbial Communities From Minnesota, Usa, Analyzing Carbon Cycling And Trace Gas Fluxes

Source Dataset Sampling Location

• Location Name: USA: Michigan
• Coordinates
  • Lat. (^o): 47.1149
  • Long. (^o): -88.5476
  • Depth (m): .3 to .4

Associated Families

Family	Category	Number of Sequences	3D Structure?
F058297	Metagenome / Metatranscriptome	135	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0181515_11459064	F058297	GGGGG	MKKTAFVLIMMFSMFAFAADTYQQGKIVKWENGTYADKSKKHPTKNWIVYQLQTDTTTYSIARQKETKPQMQAGDVVQYELKKNTQINVIDANGKKHEYQIVGQTAGPGQ