| Basic Information | |
|---|---|
| Taxon OID | 3300016720 Open in IMG/M |
| Scaffold ID | Ga0186461_101754 Open in IMG/M |
| Source Dataset Name | Metatranscriptome of marine eukaryotic communities from English Channel in f/20 medium with seawater, no silicate, 18 C, 30 psu salinity and 317 ?mol photons light - Alexandrium tamarense CCMP 1771 (MMETSP0380) |
| Source Dataset Category | Metatranscriptome |
| Source Dataset Use Policy | Open |
| Sequencing Center | National Center for Genome Resources |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 952 |
| Total Scaffold Genes | 1 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated → The Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp) |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | English Channel | |||||||
| Coordinates | Lat. (o) | 50.6 | Long. (o) | 4.25 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F016530 | Metatranscriptome | 246 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0186461_1017541 | F016530 | GGAGG | MLGLGVSDAMNEKQMQVLNGQVALMTSADYVASKKDSELELKEAYKQQWQYEAEQRLARIEAKKSPLERAGEGGMMKSQKFAWSKDGQKSFEWRKIYHALVGGVGGMPEGGLFTETVISPTAMRMYTDHRVMGAVVLPGVSHVSLMAATGSVGFPSPGGLANDWHMSIKETLFERPYIVNSGAELIAAISAGMDPSQVGGGGGGMQAAMLPVGVPMTYCRATGVGKERGQIKPTSDWAK |
| ⦗Top⦘ |