Scaffold Ga0186423_108095

Overview

Basic Information

• Taxon OID: 3300016706
• Scaffold ID: Ga0186423_108095
• Source Dataset Name: Metatranscriptome of marine eukaryotic communities from Gulf of Naples in f/2 medium with Monterey Bay seawater w/o silicate, 21 C, 35 psu salinity and 305 ?mol photons light - micromonas sp. CCMP1646 (MMETSP1080)
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: National Center for Genome Resources
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 668
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota → Viridiplantae → Chlorophyta → Mamiellophyceae → Mamiellales → Mamiellaceae → Micromonas → Micromonas pusilla (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated → The Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp)

Source Dataset Sampling Location

• Location Name: Gulf of Naples
• Coordinates
  • Lat. (^o): 40.75
  • Long. (^o): 14.33

Associated Families

Family	Category	Number of Sequences	3D Structure?
F021976	Metagenome / Metatranscriptome	216	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0186423_1080951	F021976	N/A	VHAASAAMVAEAARGVETRARKSKRELDAQAGVAFPGLPFDVAVSLVEKHLPDPADLA