NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0180059_1186751

Scaffold Ga0180059_1186751


Overview

Basic Information
Taxon OID3300016695 Open in IMG/M
Scaffold IDGa0180059_1186751 Open in IMG/M
Source Dataset NameEutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES164 metaT (Metagenome Metatranscriptome)
Source Dataset CategoryMetatranscriptome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)806
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater → Freshwater Microbial Communities From Oligotrophic, Dystrophic, And Eutrophic Lakes In Wisonsin, Usa

Source Dataset Sampling Location
Location NameUSA: Madison
CoordinatesLat. (o)43.099Long. (o)-89.405Alt. (m)Depth (m)7
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F005697Metagenome / Metatranscriptome392Y
F025683Metagenome / Metatranscriptome200Y

Sequences

Protein IDFamilyRBSSequence
Ga0180059_11867511F025683N/AYRQESGEFKMVLDLLDPETLGRLVLAIILMVISAAAGYAKGFKEGKREGMARRKAMVRHMSNKAVN
Ga0180059_11867512F005697AGGCGGMGFLDNYEASRERLERWNRTFPLGRIETRIVEFSAEKGYVLIEAKAFRNDTDLHPAGIDFAYGYQGAYQPNMRRWFVEDSTTSAIMRVQQLVMGGAERSTREVMEQVEKTPAKIANTDSTDYWTTKFGDVPSYKTAAEAEQSGIPSFGSSMDEIAKQLGGELVQEAPQCSHGHMIWKQSHEGAPKSWGGYFCTERTKATQC

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.