Scaffold Ga0180048_1013550

Overview

Basic Information

• Taxon OID: 3300016690
• Scaffold ID: Ga0180048_1013550
• Source Dataset Name: Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - GEODES019 metaT (Metagenome Metatranscriptome)
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1225
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Cucurbitales → Cucurbitaceae → Benincaseae → Cucumis → Cucumis melo → Cucumis melo subsp. agrestis → Cucumis melo var. makuwa (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater → Freshwater Microbial Communities From Oligotrophic, Dystrophic, And Eutrophic Lakes In Wisonsin, Usa

Source Dataset Sampling Location

• Location Name: USA: Wisconsin
• Coordinates
  • Lat. (^o): 46.008
  • Long. (^o): -89.701
  • Depth (m): 4

Associated Families

Family	Category	Number of Sequences	3D Structure?
F073598	Metagenome / Metatranscriptome	120	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0180048_10135501	F073598	GAG	MGTGGYILYQTQGNSENIKLAIKESVPGCKGPGTKGKQPRSITKVLKKKLSEKKASFIVTAKRWAWKQPSLRESVIAHWSN