Scaffold Ga0126362_10308162

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0126362_10308162

Scaffold Ga0126362_10308162

Overview

Basic Information
Taxon OID	3300016461 Open in IMG/M
Scaffold ID	Ga0126362_10308162 Open in IMG/M
Source Dataset Name	Continental margin sediment microbial communities from China - ANME2c_DSS_Sorted metaG
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	606
Total Scaffold Genes	2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	1 (50.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Unclassified → Unclassified → Continental Margin Sediment → Continental Margin Sediment Microbial Communities From Various Locations

Source Dataset Sampling Location
Location Name	China: Qiqihar, Heilongjiang
Coordinates	Lat. (^o)	47.5233	Long. (^o)	125.0078	Alt. (m)		Depth (m)	0
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F007510	Metagenome / Metatranscriptome	349	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0126362_103081621	F007510	GGA	MDGGAWWVAVHGVARSRTQLNDFSFTFHFHALEKEMATHPSVLAWRIPGTGEPGGLPSIG

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.