NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0126362_10269886

Scaffold Ga0126362_10269886


Overview

Basic Information
Taxon OID3300016461 Open in IMG/M
Scaffold IDGa0126362_10269886 Open in IMG/M
Source Dataset NameContinental margin sediment microbial communities from China - ANME2c_DSS_Sorted metaG
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)641
Total Scaffold Genes1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Unclassified → Unclassified → Continental Margin Sediment → Continental Margin Sediment Microbial Communities From Various Locations

Source Dataset Sampling Location
Location NameChina: Qiqihar, Heilongjiang
CoordinatesLat. (o)47.5233Long. (o)125.0078Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F020637Metagenome222Y

Sequences

Protein IDFamilyRBSSequence
Ga0126362_102698861F020637GGAGMDGGAWWAAVHGVAKSQIRLSDFTFTFHFHALEKEMATHSSVIAWRIPGTGPL

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.