Basic Information | |
---|---|
Taxon OID | 3300016461 Open in IMG/M |
Scaffold ID | Ga0126362_10258214 Open in IMG/M |
Source Dataset Name | Continental margin sediment microbial communities from China - ANME2c_DSS_Sorted metaG |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 652 |
Total Scaffold Genes | 3 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (33.33%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Eukaryota → Opisthokonta | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Marine → Unclassified → Unclassified → Continental Margin Sediment → Continental Margin Sediment Microbial Communities From Various Locations |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | China: Qiqihar, Heilongjiang | |||||||
Coordinates | Lat. (o) | 47.5233 | Long. (o) | 125.0078 | Alt. (m) | Depth (m) | 0 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F002002 | Metagenome / Metatranscriptome | 605 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0126362_102582142 | F002002 | AGGTGG | VVKNLPATQETQVQSLDGEDPFEEEMATHSSVLAWKISWTEEPGGLLFMGSHKSRT |
⦗Top⦘ |