| Basic Information | |
|---|---|
| Taxon OID | 3300016461 Open in IMG/M |
| Scaffold ID | Ga0126362_10074477 Open in IMG/M |
| Source Dataset Name | Continental margin sediment microbial communities from China - ANME2c_DSS_Sorted metaG |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1022 |
| Total Scaffold Genes | 1 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Eukaryota → Opisthokonta | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Unclassified → Unclassified → Continental Margin Sediment → Continental Margin Sediment Microbial Communities From Various Locations |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | China: Qiqihar, Heilongjiang | |||||||
| Coordinates | Lat. (o) | 47.5233 | Long. (o) | 125.0078 | Alt. (m) | Depth (m) | 0 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F001445 | Metagenome | 692 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0126362_100744771 | F001445 | N/A | HALEKEMATHSSVLAWRIPGTEEPSGLPSVGSHRVGHD |
| ⦗Top⦘ |