Scaffold Ga0132256_101302900

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0132256_101302900

Scaffold Ga0132256_101302900

Overview

Basic Information
Taxon OID	3300015372 Open in IMG/M
Scaffold ID	Ga0132256_101302900 Open in IMG/M
Source Dataset Name	Soil combined assembly
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Draft

Scaffold Components
Scaffold Length (bps)	839
Total Scaffold Genes	2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Archaea	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere → Arabidopsis Rhizosphere Microbial Communities From The University Of North Carolina

Source Dataset Sampling Location
Location Name	USA: Bethesda, Maryland
Coordinates	Lat. (^o)	39.0042816	Long. (^o)	-77.1012173	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F089140	Metagenome / Metatranscriptome	109	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0132256_1013029002	F089140	N/A	MSVIVSSPQFNLKVNGITNVNNTYFSIIIPNNWTYAEHSKMAMSMGESHSNGSVNLVALAPADFAKTLVVNENKDSPYGKMFNGGAYSTLRLDTDYPNKNSTLDHYAKYRINSIIPGINLTSQQNTIVGNEKAIRIDGNGLNKLKNLNYVAYLVLHDKVPYYLEYIANTKDFQKYLPQFEQMIKTFKFVK*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.