NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0132258_11325985

Scaffold Ga0132258_11325985


Overview

Basic Information
Taxon OID3300015371 Open in IMG/M
Scaffold IDGa0132258_11325985 Open in IMG/M
Source Dataset NameCombined assembly of cpr5 and col0 rhizosphere and soil
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1819
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere → Arabidopsis Rhizosphere Microbial Communities From The University Of North Carolina

Source Dataset Sampling Location
Location NameUniversity of North Carolina
CoordinatesLat. (o)35.9Long. (o)-79.05Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F018183Metagenome / Metatranscriptome236Y

Sequences

Protein IDFamilyRBSSequence
Ga0132258_113259852F018183GAGMKLDQAQILAYPRKLVEHVILGLYDQINVHLVKMVGFDFPPELRQHFRRELRAWLGKIQSLRFKPDRRPGSFKFYFDLLFDYPFGGVEVENMQRVFRQISEDYERAAPIKTPEEMVGWLRDFHTRLAERLHNGEDVLDMLPE*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.