Scaffold Ga0132258_10366265

Overview

Basic Information

• Taxon OID: 3300015371
• Scaffold ID: Ga0132258_10366265
• Source Dataset Name: Combined assembly of cpr5 and col0 rhizosphere and soil
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 3570
• Total Scaffold Genes: 6
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 5 (83.33%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_20CM_4_61_6 (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere → Arabidopsis Rhizosphere Microbial Communities From The University Of North Carolina

Source Dataset Sampling Location

• Location Name: University of North Carolina
• Coordinates
  • Lat. (^o): 35.9
  • Long. (^o): -79.05

Associated Families

Family	Category	Number of Sequences	3D Structure?
F085425	Metagenome / Metatranscriptome	111	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0132258_103662653	F085425	GGA	LGEHGSEFAATPLGRKGAMLEGVLIDQAIEVLFQRARDFGRSTGARAIQQPLEPLLGKTLYPFAQGRIRQMEGGGDGGDVLTSDHRMDSLCTAKDTRLLGLLEHDV*