Scaffold Ga0132258_10280544

Overview

Basic Information

• Taxon OID: 3300015371
• Scaffold ID: Ga0132258_10280544
• Source Dataset Name: Combined assembly of cpr5 and col0 rhizosphere and soil
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 4088
• Total Scaffold Genes: 5
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 3 (60.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere → Arabidopsis Rhizosphere Microbial Communities From The University Of North Carolina

Source Dataset Sampling Location

• Location Name: University of North Carolina
• Coordinates
  • Lat. (^o): 35.9
  • Long. (^o): -79.05

Associated Families

Family	Category	Number of Sequences	3D Structure?
F060080	Metagenome / Metatranscriptome	133	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0132258_102805444	F060080	GGAG	MRVPTLLVSSALVLGGCASVNVKKTCYGDGVCRVENNGVVTYEGPPDKVAAYEGKAKSSADAQARAEEAYLQAAKRGPSEPVRVVVIGPSTEMSDLLPLTATYHQMLEQALQGDPRIQLVPYSQVKMWAEAHSEGESTSMFAQNQVRTAVDQPLTRRLRDGSGEVDVVVVAHLSTKKVSGLVSGGGGVGVAEVNNVVFELSLSSVYKFEELRHSEVGKSSDSLALAGIDKKGKTGSGQLKGKRNPESDRPALVAVASWVKASSAQLAPTMPSIAAARDVRQKNTATALQDAPDWMKKLMSK*