| Basic Information | |
|---|---|
| Taxon OID | 3300015370 Open in IMG/M |
| Scaffold ID | Ga0180009_10224916 Open in IMG/M |
| Source Dataset Name | Groundwater microbial communities from the Aspo Hard Rock Laboratory (HRL) deep subsurface site, Sweden - OS_PC_MetaG |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 827 |
| Total Scaffold Genes | 3 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 3 (100.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Groundwater → Groundwater Microbial Communities From Three Deep Subsurface Sites In Europe |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Sweden: Oskarshamn | |||||||
| Coordinates | Lat. (o) | 57.4344 | Long. (o) | 16.66 | Alt. (m) | Depth (m) | 448 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F100933 | Metagenome / Metatranscriptome | 102 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0180009_102249161 | F100933 | AGGAGG | MDIKLEGDKLTITCIVSSGVPSSSGKSLVVATTNGFVSVADSDLKVSLNVIKPKK* |
| ⦗Top⦘ |