Scaffold Ga0182153_1118742

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0182153_1118742

Scaffold Ga0182153_1118742

Overview

Basic Information
Taxon OID	3300015328 Open in IMG/M
Scaffold ID	Ga0182153_1118742 Open in IMG/M
Source Dataset Name	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_12JUL2016_LD1 MG
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	556
Total Scaffold Genes	1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Switchgrass Phyllosphere → Phyllosphere Microbial Comminities From Bioenergy Crops Switchgrass And Miscanthus From Michigan, Usa

Source Dataset Sampling Location
Location Name	USA: Michigan
Coordinates	Lat. (^o)	42.39	Long. (^o)	-85.37	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F001014	Metagenome / Metatranscriptome	805	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0182153_11187421	F001014	N/A	MGQVRQRNGVKPPETQVLDVKYVVRNQTDVVEHRNGVKILKI*VLDLKVCIEIFQVVCLESYYSETINQMHADTSFHNRSGALMKWRETFENMSFGSKVVDWAY

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.