Basic Information | |
---|---|
Taxon OID | 3300015296 Open in IMG/M |
Scaffold ID | Ga0182157_1055041 Open in IMG/M |
Source Dataset Name | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_12JUL2016_LD1 MG |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 609 |
Total Scaffold Genes | 1 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Miscanthus Phyllosphere → Phyllosphere Microbial Comminities From Bioenergy Crops Switchgrass And Miscanthus From Michigan, Usa |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | USA: Michigan | |||||||
Coordinates | Lat. (o) | 42.39 | Long. (o) | -85.37 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F053713 | Metagenome / Metatranscriptome | 140 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0182157_10550411 | F053713 | N/A | TIPAPVFFGREREREREGRTGKRIRYYGISGTEYFERKRVDYDREAVTQNENIDICNH* |
⦗Top⦘ |