Scaffold Ga0180081_1036900

Overview

Basic Information

• Taxon OID: 3300015253
• Scaffold ID: Ga0180081_1036900
• Source Dataset Name: Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT590_16_10D
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 800
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (66.67%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil → Soil And Sediment Microbial Communities From The East River, Co, Usa

Source Dataset Sampling Location

• Location Name: USA: East River, Colorado
• Coordinates
  • Lat. (^o): 38.9227
  • Long. (^o): -106.9509
  • Depth (m): 0

Associated Families

Family	Category	Number of Sequences	3D Structure?
F011244	Metagenome	293	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0180081_10369002	F011244	N/A	MFTMSSTDELNRNLCELDAEFDREMRARGFDPAQAENVALPSHLAELYAEREKIRAQIEESKGKTND*