Scaffold Ga0137409_10184618

Overview

Basic Information

• Taxon OID: 3300015245
• Scaffold ID: Ga0137409_10184618
• Source Dataset Name: Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1888
• Total Scaffold Genes: 5
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 3 (60.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil → Vadose Zone Soil And Rhizosphere Microbial Communities From The Eel River Critical Zone Observatory, Northern California To Study Diel Carbon Cycling

Source Dataset Sampling Location

• Location Name: USA: California
• Coordinates
  • Lat. (^o): 39.7291
  • Long. (^o): -123.6419

Associated Families

Family	Category	Number of Sequences	3D Structure?
F003312	Metagenome / Metatranscriptome	494	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0137409_101846182	F003312	AGGAGG	MHPVFVTLFIETDADDALTEQQDRKRRAHAARRGRSARVVKVAAANRDRPRRP*