Scaffold Ga0137418_10540419

Overview

Basic Information

• Taxon OID: 3300015241
• Scaffold ID: Ga0137418_10540419
• Source Dataset Name: Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 925
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter agariperforans (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil → Vadose Zone Soil And Rhizosphere Microbial Communities From The Eel River Critical Zone Observatory, Northern California To Study Diel Carbon Cycling

Source Dataset Sampling Location

• Location Name: USA: California
• Coordinates
  • Lat. (^o): 39.7291
  • Long. (^o): -123.6419

Associated Families

Family	Category	Number of Sequences	3D Structure?
F059795	Metagenome / Metatranscriptome	133	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0137418_105404191	F059795	AGGAG	MSIEWPTVIEGGIPILGGLYATALGYGVIGASQSPPSAFKQNLLARFKWLGPAVVLFGVFTAWQTHLRVIHPPAEELARQIAARLSFPSKVDEITEAVGVEGKGDDLIYRYSIATSLADLGGREQVQRGLEQQLQSAVCKTKDSQKLLRAGYTVQARYSFKGSPEEILISLPPRSCGY*