| Basic Information | |
|---|---|
| Taxon OID | 3300015203 Open in IMG/M |
| Scaffold ID | Ga0167650_1035634 Open in IMG/M |
| Source Dataset Name | Arctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Sample st-3c, vegetated patch on medial moraine) |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | University of Bristol |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1307 |
| Total Scaffold Genes | 3 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (33.33%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria | (Source: IMG/M) |
| Source Dataset Ecosystem |
|---|
| Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil → Metagenomes Of Arctic Soils |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Storglaci?ren, Tarfala, Sweden | |||||||
| Coordinates | Lat. (o) | 67.900853 | Long. (o) | 18.44175 | Alt. (m) | Depth (m) | 0 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F013826 | Metagenome / Metatranscriptome | 268 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0167650_10356342 | F013826 | AGG | MAVCWRCPLCDAVSCEEDVNAIGRPVACDQCERPFPQQQTLCTVCDAPNPWSRRDSLHFLCRECGTTQTLHQIAS* |
| ⦗Top⦘ |