| Basic Information | |
|---|---|
| Taxon OID | 3300015202 Open in IMG/M |
| Scaffold ID | Ga0167663_1127273 Open in IMG/M |
| Source Dataset Name | Arctic sediment microbial communities from supraglacial cryoconite, Storglaci?ren, Tarfala, Sweden (Sample st-12a, ablation zone cryoconite) |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | University of Bristol |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 595 |
| Total Scaffold Genes | 4 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (50.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil → Metagenomes Of Arctic Soils |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Storglaci?ren, Tarfala, Sweden | |||||||
| Coordinates | Lat. (o) | 67.901457 | Long. (o) | 18.580979 | Alt. (m) | Depth (m) | 0 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F037289 | Metagenome / Metatranscriptome | 168 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0167663_11272733 | F037289 | AGGAG | MSMWLSNQSVSLALALATGLRAVQLGALSLARPATLRRAQSGVVRLITVVAGH* |
| ⦗Top⦘ |