Scaffold Ga0167627_1003624

Overview

Basic Information

• Taxon OID: 3300015196
• Scaffold ID: Ga0167627_1003624
• Source Dataset Name: Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G2C, Ice surface)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: University of Bristol
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 8125
• Total Scaffold Genes: 8
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (25.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Archangiaceae (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil → Metagenomes Of Arctic Soils

Source Dataset Sampling Location

• Location Name: Russell Glacier, Kangerlussuaq, Greenland
• Coordinates
  • Lat. (^o): 67.163069
  • Long. (^o): -50.018284
  • Depth (m): 0

Associated Families

Family	Category	Number of Sequences	3D Structure?
F029078	Metagenome / Metatranscriptome	189	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0167627_10036247	F029078	N/A	MHSLTISILRWVVHALVVMASVAIVSKGNKSNTITRALLVTFLVALLVTPFAFFWFLLIPGIIALVAWVLVYSFAYDIGIGQAFGAGILQAVIGLVVDYFLVGGRLG*