| Basic Information | |
|---|---|
| Taxon OID | 3300015195 Open in IMG/M |
| Scaffold ID | Ga0167658_1024504 Open in IMG/M |
| Source Dataset Name | Arctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Sample st-6c, vegetation/snow interface) |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | University of Bristol |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1648 |
| Total Scaffold Genes | 3 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (33.33%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil → Metagenomes Of Arctic Soils |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Storglaci?ren, Tarfala, Sweden | |||||||
| Coordinates | Lat. (o) | 67.865505 | Long. (o) | 16.714941 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F006810 | Metagenome / Metatranscriptome | 364 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0167658_10245042 | F006810 | GAG | MNRISLCFLLLSFPIVLVAQARPHQQGTIIRMRTADCLGPQHGFMAAMSGGKAEAGMLCPEYVLLADKVVYVIIGKTSGQLLPLAEVTAFRFQTDEMLIRINDAPKESHFRIKAMMLRAEWERNQMREEAEGNASVSHHLDAATIREPP* |
| ⦗Top⦘ |