Scaffold Ga0167658_1002155

Overview

Basic Information

• Taxon OID: 3300015195
• Scaffold ID: Ga0167658_1002155
• Source Dataset Name: Arctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Sample st-6c, vegetation/snow interface)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: University of Bristol
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 7926
• Total Scaffold Genes: 12
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 8 (66.67%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil → Metagenomes Of Arctic Soils

Source Dataset Sampling Location

• Location Name: Storglaci?ren, Tarfala, Sweden
• Coordinates
  • Lat. (^o): 67.865505
  • Long. (^o): 16.714941

Associated Families

Family	Category	Number of Sequences	3D Structure?
F023252	Metagenome	211	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0167658_100215512	F023252	GGCGG	MIALLFFLQTAATTLAAPIPTFIVVRDGGAIASVPVTIDGGQPSVRADALMRAMRGMLITSTNLHYTLALPRARIDLIDGIPFAKRDTLTIPLTRAPQVRGGQLYLPFQFVTDVIPRYAGGYVYDAALSELRTVTAVANRPA