Scaffold Ga0167668_1011864

Overview

Basic Information

• Taxon OID: 3300015193
• Scaffold ID: Ga0167668_1011864
• Source Dataset Name: Arctic soil microbial communities from a glacier forefield, Rabots glacier, Tarfala, Sweden (Sample Rb6, proglacial stream)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: University of Bristol
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1964
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (33.33%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Acidobacteria (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil → Metagenomes Of Arctic Soils

Source Dataset Sampling Location

• Location Name: Rabots glacier, Tarfala, Sweden
• Coordinates
  • Lat. (^o): 67.872223
  • Long. (^o): 16.713705
  • Depth (m): 0

Associated Families

Family	Category	Number of Sequences	3D Structure?
F043509	Metagenome	156	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0167668_10118642	F043509	AGG	LEEQVRHNLDRYAEFIDANPSYVVSEALKLLFKKDEEFKRWVGQHNNEHSQETIKGQAFAKNA*