NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0167646_1074973

Scaffold Ga0167646_1074973


Overview

Basic Information
Taxon OID3300015192 Open in IMG/M
Scaffold IDGa0167646_1074973 Open in IMG/M
Source Dataset NameArctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Sample st-2a, rock/snow interface)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterUniversity of Bristol
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)736
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil → Metagenomes Of Arctic Soils

Source Dataset Sampling Location
Location NameStorglaci?ren, Tarfala, Sweden
CoordinatesLat. (o)67.899243Long. (o)18.344347Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F093488Metagenome / Metatranscriptome106Y

Sequences

Protein IDFamilyRBSSequence
Ga0167646_10749732F093488GAGGMADGLFYLDTREPFVTTSPAAVTLAATAKALYTASNFPVLGGQYFARPGKKLLIYLFGVMTTAVTPGNGSFNVYYGSGADATGVVLMTGTPAALTASQTALTWMLEIVVTCVTTGSAGTLRCTGLAKFNEAIQAPMQMLPTATAAVSGACDLTAANIISVQYLRSGSTAETMQVIDMRVVSLN*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.