| Basic Information | |
|---|---|
| Taxon OID | 3300015170 Open in IMG/M |
| Scaffold ID | Ga0120098_1048288 Open in IMG/M |
| Source Dataset Name | Fossil microbial communities from human bone sample from Teposcolula Yucundaa, Mexico - TP48 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | Harvard University |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 599 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Environmental → Terrestrial → Soil → Fossil → Unclassified → Fossill → Fossil Microbial Communities From Human Bone And Soil Samples From Teposcolula Yucundaa, Mexico |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Mexico: Teposcolula Yucundaa | |||||||
| Coordinates | Lat. (o) | 17.550556 | Long. (o) | -97.425556 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F091018 | Metagenome / Metatranscriptome | 108 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0120098_10482882 | F091018 | AGGA | VTLERIDELKPRQAAIGYTLFMTIWIVAFARTERALPAVLVLVLLLLPAVVHFGLGYVVADWRALYLAGVPIVVAAVAGGLPSALWAAVVLLTAFPGAPLVAAGVYVRGWLERRDPTYVDPWLI* |
| ⦗Top⦘ |