NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0120098_1030943

Scaffold Ga0120098_1030943


Overview

Basic Information
Taxon OID3300015170 Open in IMG/M
Scaffold IDGa0120098_1030943 Open in IMG/M
Source Dataset NameFossil microbial communities from human bone sample from Teposcolula Yucundaa, Mexico - TP48
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterHarvard University
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)703
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Fossil → Unclassified → Fossill → Fossil Microbial Communities From Human Bone And Soil Samples From Teposcolula Yucundaa, Mexico

Source Dataset Sampling Location
Location NameMexico: Teposcolula Yucundaa
CoordinatesLat. (o)17.550556Long. (o)-97.425556Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F031921Metagenome / Metatranscriptome181Y

Sequences

Protein IDFamilyRBSSequence
Ga0120098_10309432F031921GGAGMTNAALTYDATARDRPLPIVSLRRWLHGRWALLFSHPDDFACYGFESDRWLVHVQEAFAATGIRPLALAGSVDAGWINDIGGRTTPITIDEIQRYPVARASSEETLRAAAFRPAARFVMTLDDSLRLRRTFVYTLRDRLPSPMDLAAAAKALRDASFARKRNGL

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.