NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0167628_1023777

Scaffold Ga0167628_1023777


Overview

Basic Information
Taxon OID3300015165 Open in IMG/M
Scaffold IDGa0167628_1023777 Open in IMG/M
Source Dataset NameArctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G3A, Proglacial river margin, by glacier terminus)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterUniversity of Bristol
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1340
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (25.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil → Metagenomes Of Arctic Soils

Source Dataset Sampling Location
Location NameRussell Glacier, Kangerlussuaq, Greenland
CoordinatesLat. (o)67.152116Long. (o)-50.048697Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F002509Metagenome / Metatranscriptome553Y

Sequences

Protein IDFamilyRBSSequence
Ga0167628_10237772F002509GAGGMSTAPNTDRTDDQLVTLLSHWLTRQIGNDELLRKVEEIGTDELAPGCRDAVGELVAELKVAAPGERAQLEVAVRETVETLVYGD*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.