Scaffold Ga0167653_1000035

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0167653_1000035

Scaffold Ga0167653_1000035

Overview

Basic Information
Taxon OID	3300015162 Open in IMG/M
Scaffold ID	Ga0167653_1000035 Open in IMG/M
Source Dataset Name	Arctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Sample st-4c, rock/ice/stream interface)
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	University of Bristol
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	100819
Total Scaffold Genes	101 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	59 (58.42%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria	(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil → Metagenomes Of Arctic Soils

Source Dataset Sampling Location
Location Name	Storglaci?ren, Tarfala, Sweden
Coordinates	Lat. (^o)	67.900879	Long. (^o)	18.43474	Alt. (m)		Depth (m)	0
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F026727	Metagenome / Metatranscriptome	197	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0167653_100003554	F026727	GAG	MSATQLAEYWQLYNDKNEPTTAGILKWSKRPADQFPLPHAYMGDLLRFNRDEVDLWAKEEGERRRVQKEKRRLKIA*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.