Scaffold Ga0167637_1031977

Overview

Basic Information

• Taxon OID: 3300015087
• Scaffold ID: Ga0167637_1031977
• Source Dataset Name: Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G6A, Proglacial plain, adjacent to northern proglacial tributary)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: University of Bristol
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 730
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil → Metagenomes Of Arctic Soils

Source Dataset Sampling Location

• Location Name: Russell glacier, Kangerlussuaq, Greenland
• Coordinates
  • Lat. (^o): 67.155592
  • Long. (^o): -50.08499
  • Depth (m): 0

Associated Families

Family	Category	Number of Sequences	3D Structure?
F016176	Metagenome / Metatranscriptome	249	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0167637_10319772	F016176	N/A	MINQYIKGIALNAALAAAILLTLSSAGLAQSGGASLHGWVAFENVAYVDKQPRAKVVLQHDPPGSGPAYSAETDEHGFFEFPHTSLGRFKLEITAKGFQPYTADVYMPSDFAG