| Basic Information | |
|---|---|
| Taxon OID | 3300015087 Open in IMG/M |
| Scaffold ID | Ga0167637_1000002 Open in IMG/M |
| Source Dataset Name | Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G6A, Proglacial plain, adjacent to northern proglacial tributary) |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | University of Bristol |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 24263 |
| Total Scaffold Genes | 26 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 21 (80.77%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | (Source: IMG/M) |
| Source Dataset Ecosystem |
|---|
| Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil → Metagenomes Of Arctic Soils |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Russell glacier, Kangerlussuaq, Greenland | |||||||
| Coordinates | Lat. (o) | 67.155592 | Long. (o) | -50.08499 | Alt. (m) | Depth (m) | 0 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F020077 | Metagenome / Metatranscriptome | 226 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0167637_100000226 | F020077 | AGG | MKAMFGFLTPQAKELSDPLQSAKAAAAWLRQLPTLDVIGRQQQVISVLDTMRKTQRVPDLNRIAAIQFVDAALGADRRQLIKQYIENSESAPKLADRIWQALWEMSKAFMLAYQSALDAAIQESDNARWKAVLPLLFVRLVHFHGTDAKLRVFKYERWIPGRWIELHSTYLRACEMQCDRQPMALPAAGPAAQP |
| ⦗Top⦘ |