Scaffold Ga0167639_1028258

Overview

Basic Information

• Taxon OID: 3300015080
• Scaffold ID: Ga0167639_1028258
• Source Dataset Name: Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G6C, Proglacial plain, adjacent to northern proglacial tributary)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: University of Bristol
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 772
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (33.33%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → unclassified Gemmatimonadaceae → Gemmatimonadaceae bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil → Metagenomes Of Arctic Soils

Source Dataset Sampling Location

• Location Name: Russell glacier, Kangerlussuaq, Greenland
• Coordinates
  • Lat. (^o): 67.155672
  • Long. (^o): -50.084881
  • Depth (m): 0

Associated Families

Family	Category	Number of Sequences	3D Structure?
F016259	Metagenome / Metatranscriptome	248	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0167639_10282582	F016259	AGGA	VSPFTVAKLALMLIAAILLGWGIRADDAALRWAGIAFLFIALILRFIKKPRRFQ*