Scaffold Ga0167657_1028029

Overview

Basic Information

• Taxon OID: 3300015079
• Scaffold ID: Ga0167657_1028029
• Source Dataset Name: Arctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Sample st-6b, vegetation/snow interface)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: University of Bristol
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 701
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil → Metagenomes Of Arctic Soils

Source Dataset Sampling Location

• Location Name: Storglaci?ren, Tarfala, Sweden
• Coordinates
  • Lat. (^o): 67.865505
  • Long. (^o): 16.714941
  • Depth (m): 0

Associated Families

Family	Category	Number of Sequences	3D Structure?
F024932	Metagenome / Metatranscriptome	204	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0167657_10280291	F024932	N/A	DMWVATVVTNDPHVGTNPERNTFYGFHPNPGYDDWYGYFYGDFRGSPGDASGWVKLLHENYPDHYHWNFATNGWSVHGHAKEYMAYYNWTFGGQCGLGAYGSASPPPFMADQYGYPVVDIYVDSRPPYPAQPRVTDISTSSVAFTWDPVGDQGDGAGKDFFAAGMGQYSSWLTLGSSTRRLQAASTRAPRMLTLSDVKPGERACVHVIALDRLMNATPESVACAGPLAPPPVP