Scaffold Ga0167657_1016545

Overview

Basic Information

• Taxon OID: 3300015079
• Scaffold ID: Ga0167657_1016545
• Source Dataset Name: Arctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Sample st-6b, vegetation/snow interface)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: University of Bristol
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 980
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (100.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA117 (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil → Metagenomes Of Arctic Soils

Source Dataset Sampling Location

• Location Name: Storglaci?ren, Tarfala, Sweden
• Coordinates
  • Lat. (^o): 67.865505
  • Long. (^o): 16.714941
  • Depth (m): 0

Associated Families

Family	Category	Number of Sequences	3D Structure?
F008900	Metagenome / Metatranscriptome	326	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0167657_10165451	F008900	AGCAG	MTSSSPINSKSTYFVVSPDGRQIAIPSELFGLLWDFLEGNKQTGSIIVQFRNGGVAGLESFVKKTYK*