| Basic Information | |
|---|---|
| Taxon OID | 3300015077 Open in IMG/M |
| Scaffold ID | Ga0173483_10173201 Open in IMG/M |
| Source Dataset Name | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S178-409R-2 (version 2) |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 972 |
| Total Scaffold Genes | 3 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil → Soil Microbial Communities From Arlington Agricultural Research Station In Wisconsin And Kellogg Biological Station In Michigan, Replicating The Bioenergy Cropping Systems Trials (Bcsts) |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | USA: Wisconsin | |||||||
| Coordinates | Lat. (o) | 43.3 | Long. (o) | -89.38 | Alt. (m) | Depth (m) | 0 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F012355 | Metagenome | 281 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0173483_101732012 | F012355 | N/A | MKKLFLILAYIFIPTLFFAQTKELPDCKTIKKEIAEVHNSFDNIVEKFRSKEDKVSLVKTYFSDFSICSEKGKIKDYGRSIEFIFYFTDAYYKGSRLEFRNFYKRIFKKIKNEFAATHVYKISKEQSAKSSYFYEKGKEMTSSKRNIKLLLSYKDPVDKTTAYSVSLIFDYYPKR* |
| ⦗Top⦘ |