Scaffold Ga0167656_1025250

Overview

Basic Information

• Taxon OID: 3300015076
• Scaffold ID: Ga0167656_1025250
• Source Dataset Name: Arctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Sample st-6a, vegetation/snow interface)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: University of Bristol
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 691
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil → Metagenomes Of Arctic Soils

Source Dataset Sampling Location

• Location Name: Storglaci?ren, Tarfala, Sweden
• Coordinates
  • Lat. (^o): 67.865505
  • Long. (^o): 16.714941
  • Depth (m): 0

Associated Families

Family	Category	Number of Sequences	3D Structure?
F045386	Metagenome	153	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0167656_10252501	F045386	AGGA	LTLERIEITPFAVAIIRPPMRKVLYWSQGELVLITSTAPEDSLGDFLVRRGVIQTDKAMLMVSEDPTEVVSKFHEAGMLELSWRQTLLREWVATQFVPLFSLDEGTSL