Scaffold Ga0167669_1051272

Overview

Basic Information

• Taxon OID: 3300015024
• Scaffold ID: Ga0167669_1051272
• Source Dataset Name: Arctic sediment microbial communities from supraglacial cryoconite, Rabots glacier, Tarfala, Sweden (Sample Rb cryoconite)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: University of Bristol
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1704
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (33.33%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil → Metagenomes Of Arctic Soils

Source Dataset Sampling Location

• Location Name: Rabots glacier, Tarfala, Sweden
• Coordinates
  • Lat. (^o): 67.910855
  • Long. (^o): 18.470863
  • Depth (m): 0

Associated Families

Family	Category	Number of Sequences	3D Structure?
F013906	Metagenome / Metatranscriptome	267	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0167669_10512723	F013906	N/A	GKAIALLRLELRACWERSDHPGARSALAQLTQRAGNDNELAAEIRRWGFKLAA*