Scaffold Ga0167669_1005507

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0167669_1005507

Scaffold Ga0167669_1005507

Overview

Basic Information
Taxon OID	3300015024 Open in IMG/M
Scaffold ID	Ga0167669_1005507 Open in IMG/M
Source Dataset Name	Arctic sediment microbial communities from supraglacial cryoconite, Rabots glacier, Tarfala, Sweden (Sample Rb cryoconite)
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	University of Bristol
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	8746
Total Scaffold Genes	12 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	5 (41.67%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil → Metagenomes Of Arctic Soils

Source Dataset Sampling Location
Location Name	Rabots glacier, Tarfala, Sweden
Coordinates	Lat. (^o)	67.910855	Long. (^o)	18.470863	Alt. (m)		Depth (m)	0
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F005599	Metagenome / Metatranscriptome	395	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0167669_100550711	F005599	N/A	VKPEQASKVMMRMPTRLDNGEGRTGGEEIDERTRSIRRGNGHGTLEW*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.