NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0167669_1001593

Scaffold Ga0167669_1001593


Overview

Basic Information
Taxon OID3300015024 Open in IMG/M
Scaffold IDGa0167669_1001593 Open in IMG/M
Source Dataset NameArctic sediment microbial communities from supraglacial cryoconite, Rabots glacier, Tarfala, Sweden (Sample Rb cryoconite)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterUniversity of Bristol
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)19112
Total Scaffold Genes30 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)26 (86.67%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Associated Families3

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil → Metagenomes Of Arctic Soils

Source Dataset Sampling Location
Location NameRabots glacier, Tarfala, Sweden
CoordinatesLat. (o)67.910855Long. (o)18.470863Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F003439Metagenome / Metatranscriptome486Y
F019636Metagenome / Metatranscriptome228Y
F070899Metagenome / Metatranscriptome122Y

Sequences

Protein IDFamilyRBSSequence
Ga0167669_100159310F003439AGAAGMTVNHSRSQNAALDEGASDGKYRKRRPNTTVIPGDGDQTVQKNRDGLHVFMNYGYINSEYSDKVNPGR*
Ga0167669_100159312F070899AGAAGMELSHTLLTDSTGSGMAGAEDVSLEQQKRLKETYYNGSKPCVEGCGNTLNPVQSLHSGTCSSCSRRKHSELLKGKMA*
Ga0167669_100159314F019636GGAGGVAGRQADGVYGRRAWTAPLEAAYPPQQYIGPFASNAERLVSQSLAANTMTGIELQTYVRPPLPQIKLFPDRFGYETSEIGVRDILQLSRYSNQRVNPDFSQTAATTQSSSRNTLGTSI*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.