| Basic Information | |
|---|---|
| Taxon OID | 3300014963 Open in IMG/M |
| Scaffold ID | Ga0134523_1026087 Open in IMG/M |
| Source Dataset Name | Human fecal microbial communities from elderly subjects during probiotic consumption in Boston, USA - meta_42827d56 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | University of Maryland School of Medicine |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 2391 |
| Total Scaffold Genes | 6 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 3 (50.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria | (Source: IMG/M) |
| Source Dataset Ecosystem |
|---|
| Host-Associated → Human → Digestive System → Large Intestine → Fecal → Human Fecal → Human Fecal Microbial Communities From Elderly Subjects During Probiotic Consumption In Boston, Usa |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | USA: Boston | |||||||
| Coordinates | Lat. (o) | 42.3601 | Long. (o) | -71.0589 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F039198 | Metagenome | 164 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0134523_10260875 | F039198 | AGG | MKLTIAEIQGTKYIQIYLTEEELQKKETKDLVKKYKQEKYSVAIFVSGKENYPEILEKIITKQVELNRNVC* |
| ⦗Top⦘ |