Scaffold Ga0134523_1021371

Overview

Basic Information

• Taxon OID: 3300014963
• Scaffold ID: Ga0134523_1021371
• Source Dataset Name: Human fecal microbial communities from elderly subjects during probiotic consumption in Boston, USA - meta_42827d56
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: University of Maryland School of Medicine
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 2928
• Total Scaffold Genes: 6
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 4 (66.67%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Human → Digestive System → Large Intestine → Fecal → Human Fecal → Human Fecal Microbial Communities From Elderly Subjects During Probiotic Consumption In Boston, Usa

Source Dataset Sampling Location

• Location Name: USA: Boston
• Coordinates
  • Lat. (^o): 42.3601
  • Long. (^o): -71.0589

Associated Families

Family	Category	Number of Sequences	3D Structure?
F077320	Metagenome	117	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0134523_10213713	F077320	AGGAGG	MKRKGMHRRRKLVLLAVLLIMVGIAVWRIWQTPRPTVLHRQDAWLSSAEPEMVDTLPDNAFTAELPEEIDGRLSYIRDYSASGHYQIVWEDVSAEAAESYLTALLDKGFTRLMGTAEDIASGVLLARGDLTLSISLSGGTLNMLMTRAEEPTATPLPEWLADW*