Scaffold Ga0134316_1014784

Overview

Basic Information

• Taxon OID: 3300014960
• Scaffold ID: Ga0134316_1014784
• Source Dataset Name: Surface water microbial communities from Bangladesh - BaraHaldiaSW0709
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: University of Tennessee
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 847
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Surface Water → Surface And Well Water Microbial Communities From Bara Haldia, Bangladesh

Source Dataset Sampling Location

• Location Name: Bangladesh: Bara Haldia, Matlab upazilla
• Coordinates

Associated Families

Family	Category	Number of Sequences	3D Structure?
F015331	Metagenome / Metatranscriptome	255	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0134316_10147841	F015331	N/A	NLKWPAAPNEADFAVFESYCKGKVLLLGSTKMLLPLATEAWDLEPKYEDPKIKNKDWFTLDEHFDTIIVDGALAFGKEYCERMLAAVLPHCDRFVARAFLNPNWPTKYAVYFPTAEQLTPQPQEHKINEVYTFYIWNNKQS*