Scaffold Ga0134299_1035379

Overview

Basic Information

• Taxon OID: 3300014959
• Scaffold ID: Ga0134299_1035379
• Source Dataset Name: Marine microbial communities to study oil droplet degradation from Trondheimsfjord, Norway - 0148 : 4 days incubation
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: Battelle Memorial Institute, Gulf Coast Restoration Organization
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 757
• Total Scaffold Genes: 4
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: Not Available (Source: )

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Coastal → Unclassified → Marine → Marine Microbial Communities To Study Oil Droplet Degradation From Trondheimsfjord, Norway

Source Dataset Sampling Location

• Location Name: Norway: Trondheimsfjord
• Coordinates
  • Lat. (^o): 63.43
  • Long. (^o): 10.43
  • Depth (m): 90

Associated Families

Family	Category	Number of Sequences	3D Structure?
F022530	Metagenome	214	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0134299_10353791	F022530	GGGGG	VIEKFKNVSVGYLAFGLGTICGSIIASIVGTLVYQVVSGNEHAAEILKITECLEERAEK*