Scaffold Ga0134299_1026550

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0134299_1026550

Scaffold Ga0134299_1026550

Overview

Basic Information
Taxon OID	3300014959 Open in IMG/M
Scaffold ID	Ga0134299_1026550 Open in IMG/M
Source Dataset Name	Marine microbial communities to study oil droplet degradation from Trondheimsfjord, Norway - 0148 : 4 days incubation
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	Battelle Memorial Institute, Gulf Coast Restoration Organization
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	928
Total Scaffold Genes	2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	2 (100.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Coastal → Unclassified → Marine → Marine Microbial Communities To Study Oil Droplet Degradation From Trondheimsfjord, Norway

Source Dataset Sampling Location
Location Name	Norway: Trondheimsfjord
Coordinates	Lat. (^o)	63.43	Long. (^o)	10.43	Alt. (m)		Depth (m)	90
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F094414	Metagenome	106	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0134299_10265502	F094414	AGTAG	LSYQGWVLYAHPFLLGEIMSNLPENGPFKEATEATTDDVVRQELVTYKKRDGYLVRQTTVRVFDSVDYIDNTTTAVLFKL*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.