NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0134299_1003580

Scaffold Ga0134299_1003580


Overview

Basic Information
Taxon OID3300014959 Open in IMG/M
Scaffold IDGa0134299_1003580 Open in IMG/M
Source Dataset NameMarine microbial communities to study oil droplet degradation from Trondheimsfjord, Norway - 0148 : 4 days incubation
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterBattelle Memorial Institute, Gulf Coast Restoration Organization
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)5134
Total Scaffold Genes12 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)6 (50.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Coastal → Unclassified → Marine → Marine Microbial Communities To Study Oil Droplet Degradation From Trondheimsfjord, Norway

Source Dataset Sampling Location
Location NameNorway: Trondheimsfjord
CoordinatesLat. (o)63.43Long. (o)10.43Alt. (m)Depth (m)90
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F066839Metagenome126Y

Sequences

Protein IDFamilyRBSSequence
Ga0134299_10035805F066839GGAMIRVKIQYREMTERHCKKFWQDYPEEHSCGHKWTDPEILDAVWEQWNNGSGKECDLFKKLEVRSMMVGDYVSILRPKVASVWHECLPIGWRINVPWEEVLGKVERKDFSGVDEPTVKQALINQLENDRWWDNTIKNNSLIWEDHKVN*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.