Scaffold Ga0134385_100036

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0134385_100036

Scaffold Ga0134385_100036

Overview

Basic Information
Taxon OID	3300014941 Open in IMG/M
Scaffold ID	Ga0134385_100036 Open in IMG/M
Source Dataset Name	Human fecal microbial communities from obese patients in Germany - AS63_0
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	University of Hohenheim
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	86211
Total Scaffold Genes	113 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	23 (20.35%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Human → Digestive System → Large Intestine → Fecal → Human Fecal → Human Fecal Microbial Communities From Obese Patients In Germany

Source Dataset Sampling Location
Location Name	Germany
Coordinates	Lat. (^o)		Long. (^o)		Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F064817	Metagenome	128	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0134385_10003673	F064817	N/A	MNIKNLFNRFRKREPELSYSLNLIYLEDTKVVFNQNIQCAKDLENYLSAYMRLFGMYSDKPYVLIYQEYKSRYWVYDKEPYLLYYKVPLLVNLSRKLSGKSDMVITKEKYQAAKDLVPAHEVSDRFKIPDYITGVFTDIWYKCQGYMDTDHVDLEEILELMHYNWLKEFELLVFKRNYDTDMLFLNHSLTYILDQTEEDDQRIGIQNIIERNINQENQDENETI*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.