| Basic Information | |
|---|---|
| Taxon OID | 3300014887 Open in IMG/M |
| Scaffold ID | Ga0180302_10303191 Open in IMG/M |
| Source Dataset Name | Subseafloor sediment microbial communities from Guaymas Basin, Gulf of California, Mexico - Guay17, Core 4571-4, 12-15 cm |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 653 |
| Total Scaffold Genes | 3 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (66.67%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Archaea | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Hydrothermal Vents → Sediment → Marine Sediment → Subseafloor Sediment Microbial Communities From Guaymas Basin, Gulf Of California, Mexico |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Mexico: Gulf of California | |||||||
| Coordinates | Lat. (o) | 27.0154 | Long. (o) | -111.3798 | Alt. (m) | Depth (m) | 2000 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F019588 | Metagenome | 228 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0180302_103031911 | F019588 | GGAGG | MGEEKRIEEEVKEVLEQLKVPYSVEIVIVDDKSGKVVFRWRRGRGNLVKGMQKTIEVLDRKIGIPVRDLLK* |
| ⦗Top⦘ |