Scaffold Ga0180074_1140370

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0180074_1140370

Scaffold Ga0180074_1140370

Overview

Basic Information
Taxon OID	3300014877 Open in IMG/M
Scaffold ID	Ga0180074_1140370 Open in IMG/M
Source Dataset Name	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT366_16_10D
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	541
Total Scaffold Genes	1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil → Soil And Sediment Microbial Communities From The East River, Co, Usa

Source Dataset Sampling Location
Location Name	USA: East River, Colorado
Coordinates	Lat. (^o)	38.9228	Long. (^o)	-106.9515	Alt. (m)		Depth (m)	0
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F082933	Metagenome	113	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0180074_11403701	F082933	N/A	MVLTVLLAVFAAVALQGPDKMTTVRAFVYTATGASGQPTAEEKGRLDAVRDMCDALEKKKGITLVNSREDANLLIEVLSREQREEPGTGPFGGKSVTRMGDTIIRLHVKSGDEESDLKGMGQGTWGRAAKDAADRVVKWIARREPKRSGQ*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.