| Basic Information | |
|---|---|
| Taxon OID | 3300014868 Open in IMG/M |
| Scaffold ID | Ga0180088_1086796 Open in IMG/M |
| Source Dataset Name | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT830_16_10D |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 564 |
| Total Scaffold Genes | 1 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil → Soil And Sediment Microbial Communities From The East River, Co, Usa |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | USA: East River, Colorado | |||||||
| Coordinates | Lat. (o) | 38.9228 | Long. (o) | -106.952 | Alt. (m) | Depth (m) | 0 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F006128 | Metagenome / Metatranscriptome | 381 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0180088_10867961 | F006128 | AGGAG | MGIEGLGFFVGLIGAIWMKSSINLMRERREQPELKMIGREPEDPALKAFIRGLSLILVGLALETYARLFLH* |
| ⦗Top⦘ |